HORDB

ID: hor005555
Uniprot ID: Q03191
Protein name: Trefoil factor 3
Gene name: Tff3
Organism: Rattus norvegicus (Rat)
Family: NA
Source: animal
Expression: Up-regulated by hypoxia in gastric epithelial cells. Up-regulated by hypoxia-inducible factor 1 alpha (HIF1A). |Expressed in goblet cells of the intestines, and colon, in paraventricular hypothalamus and supraoptic nuclei. Weakly expressed in gastric epit
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005515 protein binding; GO:0042802 identical protein binding
GO BP: GO:0010906 regulation of glucose metabolic process; GO:0030277 maintenance of gastrointestinal epithelium; GO:0043434 response to peptide hormone
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030141 secretory granule

Sequence: QEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
Length: 59
Propeptide: METRAFWTTLLLVLVAGSSCKAQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
Signal peptide: METRAFWTTLLLVLVAGSSCKA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005555_AF2.pdb

hor005555_ESM.pdb

Mass:	759912	Formula:	C282H427N75O90S8
Absent amino acids:	H	Common amino acids:	CPV
pI:	4.1	Basic residues:	3
Polar residues:	24	Hydrophobic residues:	15
Hydrophobicity:	-20.34	Boman Index:	-8702
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	51.02
Instability Index:	7108.81	Extinction Coefficient cystines:	7365
Absorbance 280nm:	126.98

PubMed ID: 1763017
Title: Identification and characterization of rat intestinal trefoil factor: tissue- and cell-specific member of the trefoil protein family.
PubMed ID: 1439565
Title: Molecular and cellular analysis of rP1.B in the rat hypothalamus: in situ hybridization and immunohistochemistry of a new P-domain neuropeptide.
PubMed ID: 1637322
Title: Localization of intestinal trefoil-factor mRNA in rat stomach and intestine by hybridization in situ.
PubMed ID: 8454642
Title: Identification of human intestinal trefoil factor. Goblet cell-specific expression of a peptide targeted for apical secretion.
PubMed ID: 19076725
Title: Induction of trefoil factor (TFF)1, TFF2 and TFF3 by hypoxia is mediated by hypoxia inducible factor-1: implications for gastric mucosal healing.